Loading...
Statistics
Advertisement

Tom Weller Presents
www.tweller.com/

Tweller.com

Advertisement
Tweller.com is hosted in United States / Berkeley . Tweller.com uses HTTPS protocol. Number of used technologies: 1. First technologies: Html, Number of used javascripts: 0. Number of used analytics tools: 0. Its server type is: Apache.

Technologies in use by Tweller.com

Technology

Number of occurences: 1
  • Html

Advertisement

Server Type

  • Apache

Conversion rate optimization

visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Tweller.com

SSL certificate

    • name: /CN=*.lmi.net
    • subject:
      • CN: *.lmi.net
    • hash: e3e61cdd
    • issuer:
      • C: US
      • O: GeoTrust Inc.
      • CN: RapidSSL SHA256 CA
    • version: 2
    • serialNumber: 109758483662611825945692197824263644807
    • validFrom: 160615000000Z
    • validTo: 170615235959Z
    • validFrom_time_t: 1465948800
    • validTo_time_t: 1497571199
    • extensions:
      • subjectAltName: DNS:*.lmi.net, DNS:lmi.net
      • basicConstraints: CA:FALSE
      • crlDistributionPoints: Full Name: URI:http://gp.symcb.com/gp.crl
      • certificatePolicies: Policy: 2.23.140.1.2.1 CPS: https://www.rapidssl.com/legal User Notice: Explicit Text: https://www.rapidssl.com/legal
      • authorityKeyIdentifier: keyid:97:C2:27:50:9E:C2:C9:EC:0C:88:32:C8:7C:AD:E2:A6:01:4F:DA:6F
      • keyUsage: Digital Signature, Key Encipherment
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • authorityInfoAccess: OCSP - URI:http://gp.symcd.com CA Issuers - URI:http://gp.symcb.com/gp.crt
      • 1.3.6.1.4.1.11129.2.4.2: óñvÝë+z O¦ ‹­hp~.ŽÕ\ˆ=ÄͶì¾ÌUSßo«G0E!¸Óö/óëYê¿3ŸRß•‰e5¡'ðï6`ä¼¥×|; QÈX­`|ܱ i"~ˆðŒqPL«]¶®q·÷6k|&w¤¹ ´X‡»¢Ìgp <5˜ù߸ãwÍÈ ÜUSßoÆH0F!–bWpf$3˜Íä#CV¨¯²7jÎIJÎëm!!½Í`aRko¾ÒWSB‡‘>dˆ6fiØq‹Ñ3"óZô¿

Meta - Tweller.com

Number of occurences: 0

Server / Hosting

  • IP: 66.117.151.35
  • Latitude: 37.87
  • Longitude: -122.26
  • Country: United States
  • City: Berkeley

Rname

  • ns2.lmi.net
  • ns3.lmi.net
  • cheese.lanminds.net
  • lanshark.lmi.net
  • lanfill.lmi.net

Target

  • admin.lmi.net

HTTP Header Response

HTTP/1.1 200 OK Date: Wed, 31 Aug 2016 22:48:07 GMT Server: Apache Last-Modified: Fri, 12 Aug 2016 20:31:15 GMT ETag: "1a40-539e5c3a0f0c7" Accept-Ranges: bytes Content-Length: 6720 Vary: Accept-Encoding Content-Type: text/html X-Cache: MISS from s_mf40 X-Cache-Lookup: MISS from s_mf40:80 Via: 1.1 s_mf40 (squid/3.5.20) Connection: keep-alive

DNS

host: tweller.com
  1. class: IN
  2. ttl: 43200
  3. type: A
  4. ip: 66.117.151.35
host: tweller.com
  1. class: IN
  2. ttl: 43200
  3. type: NS
  4. target: ns2.lmi.net
host: tweller.com
  1. class: IN
  2. ttl: 43200
  3. type: NS
  4. target: ns3.lmi.net
host: tweller.com
  1. class: IN
  2. ttl: 43200
  3. type: NS
  4. target: cheese.lanminds.net
host: tweller.com
  1. class: IN
  2. ttl: 43200
  3. type: SOA
  4. mname: ns2.lmi.net
  5. rname: admin.lmi.net
  6. serial: 2016081502
  7. refresh: 10800
  8. retry: 3600
  9. expire: 604800
  10. minimum-ttl: 3600
host: tweller.com
  1. class: IN
  2. ttl: 43200
  3. type: MX
  4. pri: 30
  5. target: lanshark.lmi.net
host: tweller.com
  1. class: IN
  2. ttl: 43200
  3. type: MX
  4. pri: 20
  5. target: lanfill.lmi.net

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.weller.com, www.tqweller.com, www.qweller.com, www.taweller.com, www.aweller.com, www.t weller.com, www. weller.com, www.twweller.com, www.wweller.com, www.teweller.com, www.eweller.com, www.tzweller.com, www.zweller.com, www.txweller.com, www.xweller.com, www.tcweller.com, www.cweller.com, www.teller.com, www.tw eller.com, www.t eller.com, www.twceller.com, www.tceller.com, www.tweller.com, www.teller.com, www.twdeller.com, www.tdeller.com, www.twfeller.com, www.tfeller.com, www.twgeller.com, www.tgeller.com, www.twbeller.com, www.tbeller.com, www.twller.com, www.twexller.com, www.twxller.com, www.twesller.com, www.twsller.com, www.twewller.com, www.twwller.com, www.twerller.com, www.twrller.com, www.twefller.com, www.twfller.com, www.twevller.com, www.twvller.com, www.twecller.com, www.twcller.com, www.tweqller.com, www.twqller.com, www.twealler.com, www.twaller.com, www.tweyller.com, www.twyller.com, www.tweler.com, www.tweluler.com, www.tweuler.com, www.twel8ler.com, www.twe8ler.com, www.twel9ler.com, www.twe9ler.com, www.tweljler.com, www.twejler.com, www.twel0ler.com, www.twe0ler.com, www.twelmler.com, www.twemler.com, www.twelpler.com, www.twepler.com, www.tweloler.com, www.tweoler.com, www.tweler.com, www.twelluer.com, www.tweluer.com, www.twell8er.com, www.twel8er.com, www.twell9er.com, www.twel9er.com, www.twelljer.com, www.tweljer.com, www.twell0er.com, www.twel0er.com, www.twellmer.com, www.twelmer.com, www.twellper.com, www.twelper.com, www.twelloer.com, www.tweloer.com, www.twellr.com, www.twellexr.com, www.twellxr.com, www.twellesr.com, www.twellsr.com, www.twellewr.com, www.twellwr.com, www.twellerr.com, www.twellrr.com, www.twellefr.com, www.twellfr.com, www.twellevr.com, www.twellvr.com, www.twellecr.com, www.twellcr.com, www.twelleqr.com, www.twellqr.com, www.twellear.com, www.twellar.com, www.twelleyr.com, www.twellyr.com, www.twelle.com, www.twelleri.com, www.twellei.com, www.twellero.com, www.twelleo.com, www.twellerl.com, www.twellel.com, www.twellerl.com, www.twellel.com, www.tweller..com, www.twelle..com,

Other websites we recently analyzed

  1. wartwood.ru
    Russian Federation - 31.31.204.59
    Server software: nginx
    Technology: CSS, Html, Html5
    Number of Javascript: 3
    Number of meta tags: 2
  2. putabirdonit
    Brea (United States) - 69.163.153.119
    Server software: Apache
    Technology: Html, Html5, Javascript
    Number of Javascript: 1
    Number of meta tags: 2
  3. pleasegivewillyapleasemaamsir.biz
    Scottsdale (United States) - 50.63.202.45
    Server software: Microsoft-IIS/7.5
    Technology: Html, Html5, Iframe
  4. TXMayday Enterprises - Airplane enginees, parts
    The web-based aircraft parts locater system, marketplace and business network for the aviation industry. We bring buyers and sellers together - global, fast and effective
    Scottsdale (United States) - 50.63.196.46
    Server software: Microsoft-IIS/7.0
    Technology: CSS, Html, Javascript, Php
    Number of Javascript: 5
    Number of meta tags: 5
  5. spherepr.net
    Australia - 202.124.241.178
    Server software: Redirector - NetRegistry Pty Ltd
    Technology: Html
    Number of meta tags: 2
  6. kmlsny.com
    San Jose (United States) - 69.46.84.52
    Server software: Tengine/1.4.2
    Technology: Google Adsense, Html, Javascript, Php
    Number of Javascript: 2
    Number of meta tags: 1
  7. hollyenerqy.com
    New York (United States) - 69.172.201.217
    Server software: DOSarrest
    Technology: Html, Javascript
    Number of meta tags: 1
  8. inculata.org
    Dallas (United States) - 75.126.102.254
    Server software: Apache
    Technology: Html
    Number of meta tags: 1
  9. Винтовые сваи - Установка и продажа винтовых свай дешево!
    Винтовые сваи в Челябинске и области по низким ценам! Бесплатный расчет фундамента - быстро, качественно, гарантии!
    Germany - 37.1.219.22
    Server software: nginx/1.0.15
    Technology: CSS, Html, Javascript, jQuery, Php, Yandex.Metrika
    Number of Javascript: 7
    Number of meta tags: 2
  10. Test 33 | Home
    Test 33 | Home
    Italy - 109.168.121.67
    G Analytics ID: UA-36932869-3
    Server software: Apache
    Technology: CSS, Flexslider, Font Awesome, Google Font API, Html, Html5, Javascript, jQuery Validate, Google Analytics
    Number of Javascript: 13
    Number of meta tags: 4

Check Other Websites